competition

Pictures about competition

Congratulations aoife_whyte I would love for you and a friend to come and join me at the launch party of @fliquecosmetics in Ireland tomorrow night.  We will DM you the invite. For those of you who didnDziś wszedł mocny trening pośladków i nóg 🙈
Super zestaw: - wykroki chodzone 4x20
- przysiady ze sztangą 4x10
- zakroki 4x15
- wznosy bioder na maszynie smitha 5x20
- odwodziciele na maszynie 5x15 - uginanie leżąc na dwugłowe 4x20
Na koniec 10min interwałów- dziękuje dobranoc 🙈💪
Jak Wam wcześniej wspomniałam, przez prawie 2 lata nie robiłam treningu nóg, na początku mojej przygody ze scena, dlaczego? 
Przez swoją nieuwagę i niewiedzę, jako początkująca fitnesiara, zaburzyłam proporcje swojej sylwetki (za szeroki dół w porównaniu do wąskiej góry). Razem z @akopszostak Pracowaliśmy nad tym aby tą dysproporcję zniwelować i udało się :) odpowiedni plan treningowy siłowy i cardio oraz dieta zdziałały cuda 🤗💪
teraz czas na lekką nadbudowę nóg a przede wszystkim pośladków (jak zawsze z resztą) 🤣
Wcześniej, bez angażowania głównie mięśnia czworogłowego uda skupiałam się na takich ćwiczeniach jak: - lifty z linką wyciągu dolnego
- odwodziciele na maszynie bądź z linką wyciągu dolnego - wznosy bioder ze sztangą, hantlą, na maszynie smitha, - martwe ciągi obunóż i na jednej nodze
- dzień dobry
- intensywna praca z gumami 
Wiem, że wiele z Was moje Drogie macie podobny problem jak ja miałam, więc mam nadzieje, że ten post Wam się przyda:) z magazynem Perfect Body @olimp_sport_nutrition 🤗  #akopteam #competition #workout #fitfam #fitspo #gymlife #noexcuses #fitgirl #diet #fitfood #fitlife #fitnessgirl #fitnessmodel #fitgirls#bodybuilding#dieta #motywacja #trening #siłownia #silownia #polishgirl#newbalancepoland#olimpsportnutrition#motivation#check #bodybuilding#bikini#kasiadziurska#gymmotivation#bööty insta topsy.one💥COMPETITION TIME💥 To celebrate the launch of our 🔥HOT FIRE🔥 signature smoky palette we are giving away 10 SETS of SOSU by SJ palettes (Contour, Highlight AND including the new Eye shadow palette) 🎉🎉🎉🎉 You know what to do, like this post and tag your friends (who knows they might share!) Stay tuned to our IG LIVE at our launch party from 5pm this evening to see the winners announced ☄️❣️👍🏻🎉🌟💋 #sosubysj #winner #competition insta topsy.oneWIN the ultimate Mercedes-AMG​ taxi ride with Lewis Hamilton​ and Monster Energy​ at Mercedes-Benz​ World! Interested? Link in bio! #LH44Unleashed #LewisHamilton #Hamilton #MercedesBenz #Mercedes #AMG #Cars #MonsterEnergy #Monster #Competition #Fans #Formula1 #FormulaOne #F1 @lewishamilton @monsterenergy @mercedesbenz @mercedesamg @mbworlduk insta topsy.oneOne Arm lateral dumbbell row👊🏽 #guid #exercise #bodybuilding #personaltrainer #gym #lifestyle 
زير بغل دمبل خم نيمكت👊🏽😃 مبتدي و پيشرفته 
نكته: دمبل را بر أساس توان شخصي خودتون انتخاب كنيد طوري كه بتونيد با توكل بخدا بدون اسيب ست رو تموم كنيد😂👊🏽
زانو و دست مخالف را بر روي نيمكت طوري قرار داده تا بدون كوچكترين فشار غير اصولي بر مفصل ها و فرم صحيح تعداد را انجام دهيد؛ با دستي كه دمبل را گرفته ايد به صورت عمود بر زمين با كشيدگي در قسمت عضله زيربغل و دست نگه داريد؛ سر در راستاي بدن نگه داشته و تا حده امكان به بالا نگاه نكنيد و به گردن شكستگي ندهيد چون ممكن هست سر درد بگيريد. اين موقعيت شروع شما خواهد بود👈🏽 با كنترل بر روي فرم بدن دست را به سمت زير بغل تا زاويه ٩٠ درجه و يا كمي بيشتر هدايت كنيد و مجدد به موقعيت شروع با باز كردن كامل عضله زيربغل و ارنج برگرديد؛ حركت را مجدد بر أساس تعداد برنامه تمريني خودتون ادامه دهيد. خودم در چهار ست پانزده تا بيستايي انجام ميدهم.
هر روزتان عضلاني تَر از ديروز 👊🏽❤️ هدي 
#زندگي_به_سبك_هدي #بدنسازي #سلامتي #قدرت #ورزش #تمرين_ذهن insta topsy.oneKochane! TAK JAK OBIECAŁAM, kolejny KONKURS wraz z @iperfumy.pl_by_notino ❤ DO WYGRANIA CUDNY ROZŚWIETLACZ THE BALM, PĘDZEL DO MAKIJAŻU I TUSZ TO RZĘS ❤ ! #summeryourself ☀️
WYSTARCZY TYLKO :
🌈ZAOBSERWOWAĆ PROFIL @iperfumy.pl_by_notino oraz @madziiex
🌈 W KOMENTARZU OZNACZYĆ 3 ZNAJOMYCH
🌈WYNIKI OGŁOSZĘ ZA 7 dni 😈 POWODZENIA <3
#competition#summeryourself#iperfumybynotino#beauty#cosmetics#rozdanie#polishgirl#summer insta topsy.onemake sure to follow us @talent for more! 👏🏻
-
👉(Via Xfactor /yt )
Covered by: Nicholas McDonald
Song: A Thousand Years by Christina Perry insta topsy.oneI heard Dwayne Johnson and the Rock are twins 😎
-
FOLLOW @the_lone_survivor for more
-
-

#PS4 #xboxone #tlou #Thelastofus #fallout #fallout4 #competition #competitive #falloutmemes #battlefield1 #battlefield #starwars #battlefront #game #csgo #counterstrike #gaming #videogames #funny #memes #videogaming #gamingmemes #gamingpictures #dankmemes #recycling #csgomemes #cod insta topsy.one“The hardest fought and the probably most rewarding Team Gold medal we have had” nothing was certain but @equestrianteamgbr fought hard & maintained their unbeaten record at team championship! 👏👏🥇🇬🇧🇬🇧©FEI/ @liz.gregg #sport #FEIEuros2017 #TwoHearts #ParaDressage #Gothenburg2017 #horse #equestrian #competition #horsemanship #love insta topsy.one***WIN***WIN***WIN***
If you are coming to our show THIS SUNDAY @ THE SHOE FACTORY Union Street Belfast 
You can win some fizz!!! We are giving away A Bottle of Prosecco 
Check out our #facebook page for more info 
http://www.facebook.com/divadollsofficial 
#competition #win #prosecco #girlgroup #show #sundayfunday #entertainment #northernireland #belfast #theshoefactory #singers #music #songs #cabaret 
@unionstreetbarbelfast insta topsy.one90.9 Global FM Surabaya proudly present NGULIK – Ngumpul Cantik Summertime. Yuk.. ikuti berbagai acara dan lomba di Ngulik Summertime  dan dapatkan hadiah uang tunai total jutaan rupiah.
.
Anda bisa mengikuti Beauty Workshop with Wardah untuk mengetahui bagaimana tips dan trick merias wajah agar cantik dan up to date.
.
Anak-anak Anda punya talent di bidang modeling? Yuk.. ajak anak-anak Anda ikutan Summertime Kids Fashion Show Competition dengan hadiah jutaan rupiah trophy dan sertifikat.
.
Nah.. untuk yang hobi presenting dan broadcasting segera daftar untuk mengikuti Broadcasting Competition dengan hadiah jutaan rupiah dan kesempatan magang di Global FM sebagai radio broadcaster.
.
Ngulik Summertime dengan berbagai acara seru ini akan diadakan di Atrium Lenmarc Mall Surabaya Minggu 10 September 2017. Buruan daftar dan menangkan hadiah uang tunai total jutaan rupiah!! Ada banyak doorprize juga yang bisa Anda bawa pulang
.
Informasi lebih lanjut dan pendaftaran hubungi Ninil 0812 3399 0760 atau Dea 0813 3295 6646.
.
This event is presented by Global FM Surabaya and supported by Lenmarc Mall, Wardah, Emina, La Salle Collage, and Best Western Palilio Hotel.
.
#event #summer #mall #beauty #makeup #mua #model #modeling #fashion #fashionshow #runway #kids #broadcasting #competition #prize #campus #female #family #radio #surabaya #instagood #instagram insta topsy.oneMon Vvarm Up. ✨ #horse #jumping #competition #hardwork #happiness #horserider insta topsy.oneMAI ELEMOSINARE ATTENZIONI. CHI VUOLE ESSERCI C❗Competition❗
Theme: puppies

1. Send me a pic of a cute puppy.

2. I will put the 10 first pics in a vote

3. The users that sent me pics, canAda Beauty Workshop with Wardah di NGULIK – Ngumpul Cantik Summertime Minggu 10 September 2017 jam 11 siang di Atrium Lenmarc Mall Jalan Bukit Darmo Boulevard Surabaya. Ikutan yuk.. Anda bisa mengetahui bagaimana tips dan trick merias wajah agar cantik dan up to date.
.
Serunya lagi, 3 peserta terbaik akan mendapatkan tambahan bingkisan cantik dari Wardah Inspiring Beauty dan voucher dari La Salle Collage senilai 10 juta rupiah.
.
Biaya pendaftaran 50 ribu rupiah (free produk Wardah senilai 50 ribu rupiah + plus sertifikat) Yuk..buruan daftar, tempat terbatas.
.
Informasi lebih lanjut dan pendaftaran hubungi Ninil 0812 3399 0760 atau Dea 0813 3295 6646.
.
This event is presented by Global FM Surabaya and supported by Lenmarc Mall, Wardah, Emina, La Salle Collage, and Best Western Palilio Hotel.
.
#event #summer #mall #beauty #makeup #mua #model #modeling #fashion #fashionshow #runway #kids #broadcasting #competition #prize #campus #female #family #radio #surabaya #instagood #instagram insta topsy.oneNext Kid , Smash !!
.
.
.
#sport
#badminton
#kid
#squad17
#competition
#event
#dirgahayu
#indonesia insta topsy.oneWould love to go to @inlandseaofsound @celise_maree @haleymaree87 @stacey30983 #bathurstregion #inlandjourney #competition #throwback #scenery #landscape #skyscape #skies #landscapephotography #abcmyphoto #photodaily #photography #photooftheday #clouds #cloudyday #cloudy #cloudporn #sky #blueskies #bigsky #australia #australian #nsw #inlandaustralia #instapic #instagood #instaphoto #cloudlovers #skylovers insta topsy.one#Repost @readme.ae (@get_repost)
・・・
Win the HTC U11 - the hottest new smartphone of 2017. You can be the winner of this awesome device worth AED2,599. Follow readme.ae and enter the competition @ www.readme.ae #uae #mydubai #dubai #win #prizes #trending #competition #htcu11 #repost #giveaway #regrann insta topsy.oneТренировка ног, от нашего тренера @power_ed_95.
Ждем вас по адресу: пр.Ильича 21В💥 С Нами Лучшие 🔥.
.
.
.
#restart_donetsk #спорт #мотивация #фитнес #fitness #gym #sport #training #bodybuilding #motivation #competition #тренировки #фитнесклуб #соревнования #IFBB #donetsk #donetskcity #донецк #fitnessbikini #донецксити #донецкаяреспублика insta topsy.oneIkutan yuukk.. Summertime Kids Fashion Show Competition di NGULIK – Ngumpul Cantik Summertime. Minggu 10 September 2017 jam 2 siang di Atrium Lenmarc Mall Surabaya.
.
Salurkan bakat anak-anak Anda dan menangkan hadiah jutaan rupiah, trophy dan sertifikat. Juara 1 mendapat uang tunai 1 juta rupiah, juara 2 uang tunai 750 ribu rupiah, dan juara favorit uang tunai 500 ribu rupiah.
.
Syaratnya, anak laki-laki atau perempuan usia 5 – 12 tahun, dan menampilkan busana dengan tema Summer.
.
Yuk… buruan daftar! Pendaftaran paling lambat tanggal 5 September 2017 dengan biaya pendaftaran hanya Rp 100.000 saja.
Ajak seluruh anggota keluarga, karena akan ada banyak doorprize untuk Anda.
.
Informasi lebih lanjut dan pendaftaran hubungi Ninil 0812 3399 0760 atau Dea 0813 3295 6646.
.
This event is presented by Global FM Surabaya and supported by Lenmarc Mall, Wardah, Emina, La Salle Collage, and Best Western Palilio Hotel.
.
#event #summer #mall #beauty #makeup #mua #model #modeling #fashion #fashionshow #runway #kids #broadcasting #competition #prize #campus #female #family #radio #surabaya #instagood #instagram insta topsy.one#MagformersRI72 #RI72

@Regrann from @babiesandeverything -  Bunda, Babies and Everything akan membagikan hadiah untuk Bunda yang beruntung dalam rangka HUT #RI72!

Kami akan memilih secara acak 2 orang pemenang yang akan memenangkan Magformers Carnival Set senilai Rp 1.299.000 ribu.

Caranya:
1. FOLLOW Instagram @babiesandeverything
2. LIKE posting ini dan REPOST, TAG 5 teman Bunda dengan #MagformersRI72 #RI72 (makin banyak makin seru)
3. LIKE Facebook Page Babies and Everything (link di Bio)
4. SPAM LIKE, banjiri postingan kami sebelumnya dengan LIKE 😝

Note:
SET account ThereRegistration ready! @thewodapalooza is waiting!! @crossfibellum @noexsport @Afw_team @ossfitness @josemanuelzumoza #nextchallenge #crossfit #miami #competition #masterathlete50 #personaltrainer #muscle #Throwdown #nopainnoglory #instafriends #bofyfitness 
www.davidusandizaga.com insta topsy.oneSurround yourself with people who empower you to become better!😉👊🏻. 10 days out 😃... #naturalbodybuilding#strong#muscles#workinghard#biceps#bicepworkout#willpower#goals#heavyweights#competition#shoulders#womensphysique#dontgiveup💪🏻 insta topsy.onePunya bakat di bidang broadcasting? Ikutan yuk..Summertime Broadcasting Competition di NGULIK – Ngumpul Cantik Summertime. Minggu 10 September 2017 mulai jam 5 sore di Atrium Lenmarc Mall Surabaya.
.
Menangkan hadiah jutaan rupiah, sertifikat, dan kesempatan magang di Global FM Surabaya sebagai radio broadcaster.
.
Juara 1 mendapat uang tunai 1 juta rupiah, juara 2 uang tunai 750 ribu rupiah, dan juara favorit uang tunai 500 ribu rupiah.
Summertime Broadcasting Competition terbuka untuk pelajar SMA SMK dan Mahasiswa. Biaya pendaftaran hanya 75 ribu rupiah. Pendaftaran paling lambat 5 September 2017 dan workshop + technical meeting Sabtu 9 September 2017.
.
Ajak seluruh anggota keluarga dan teman-teman karena akan ada banyak doorprize untuk Anda.
.
Informasi lebih lanjut dan pendaftaran hubungi Ninil 0812 3399 0760 atau Dea 0813 3295 6646.
.
This event is presented by Global FM Surabaya and supported by Lenmarc Mall, Wardah, Emina, La Salle Collage, and Best Western Palilio Hotel.
.
#event #summer #mall #beauty #makeup #mua #model #modeling #fashion #fashionshow #runway #kids #broadcasting #competition #prize #campus #female #family #radio #surabaya #instagood #instagram insta topsy.one#Repost from @babiesandeverything with @regram.app ... Bunda, Babies and Everything akan membagikan hadiah untuk Bunda yang beruntung dalam rangka HUT #RI72!

Kami akan memilih secara acak 2 orang pemenang yang akan memenangkan Magformers Carnival Set senilai Rp 1.299.000 ribu.

Caranya:
1. FOLLOW Instagram @babiesandeverything
2. LIKE posting ini dan REPOST, TAG 5 teman Bunda dengan #MagformersRI72 #RI72 (makin banyak makin seru)
3. LIKE Facebook Page Babies and Everything (link di Bio)
4. SPAM LIKE, banjiri postingan kami sebelumnya dengan LIKE 😝

Note:
SET account Entweder du isst scheisse und siehst auch so aus, ... oder halt du isst gescheit dann siehst du geil aus..." #truestory #competition #wiesoglotzenallekanackenlappenlimgymwennichnacktposeunddreimalsobreitunddefiniertbinwiejederderjockel #höchstwahrscheinlich insta topsy.oneLive your life to the full X insta topsy.one

Best tweets:

Little Tikes UK 23/08/2017 09:52
It's #WinningWednesday! Follow and RT for your chance to #WIN a set of Big Waffle Blocks. #Competition ends: 23/08/2017 at midnight.
http://pic.twitter.com/0gscZrINrG
It's #WinningWednesday! Follow and RT for your chance to #WIN a set of Big Waffle Blocks. #Competition ends: 23/08/2017 at midnight. <br>http://pic.twitter.com/0gscZrINrG
Lions have plenty of competition to host draft, Super Bowl Lions president Rod Wood confirmed the team has submitted an initial proposal to host the league’s annual draft. Check out this story on detroitnews.com: http://detne.ws/2vcMRId
Ora 23/08/2017 09:44
FOLLOW & RT for the chance to #WIN a @sipsmith prize! #Competition By entering, you agree to our T&Cs (18+ Only): http://www. ora-friends.com/competition.ht ml   …
http://pic.twitter.com/1BNcLSEi8C
FOLLOW & RT for the chance to #WIN a @sipsmith prize! #Competition  By entering, you agree to our T&Cs (18+ Only):  http://www. ora-friends.com/competition.ht ml   … <br>http://pic.twitter.com/1BNcLSEi8C

West Brom's £12m summer signing Jay Rodriguez scored his first goal for the club as they beat League Two Accrington There were 274 changes made by teams across 19 matches in Tuesday's second round EFL Cup ties - a trend described as "devaluing" the ...
Fit Kit Bodycare 23/08/2017 09:40
FOLLOW & RT to enter our #competition... You could #WIN a load of our post-exercise Shower Gels! #WinItWednesday #Sport
http://pic.twitter.com/DiYsMwL0b8
The future of the Hurricanes football team now rests on a question that is both uncertain and premature to untangle: How good is Malik Rosier? The coach with more information on Rosier than anyone, after working with and watching him closely for more than ...
Kraze Club Magazine 23/08/2017 09:30
RT&F for a chance to #win a #Disney #Pixar #Cars3 set! #comp #competition #freebie #giveaway #KrazeClubMag
http://pic.twitter.com/ihRMgIPpwu
RT&F for a chance to #win a #Disney #Pixar #Cars3 set! #comp #competition #freebie #giveaway #KrazeClubMag<br>http://pic.twitter.com/ihRMgIPpwu
With Vudu on Apple TV, iTunes has competition Tue, 22 Aug 2017 20:48:00 GMT
If you want to buy or rent a movie on the Apple TV, you're no longer stuck with iTunes. The Apple TV streaming box is now opening its gates to allow customers to use other apps to buy video. The first iTunes competitor to arrive is Vudu. It's a streaming ...
OharaJewellery 23/08/2017 09:14
#follow & #retweet to #Win this Gorgeous Silver CZ Ring! Size H. #winner announced on 29th August! Good luck! #comp #giveaway #Competition
http://pic.twitter.com/X0IKfSWOOC
#follow & #retweet to #Win this Gorgeous Silver CZ Ring! Size H. #winner announced on 29th August!  Good luck! #comp #giveaway #Competition <br>http://pic.twitter.com/X0IKfSWOOC
The swift demolition and rebuilding of the Broadway bridge is garnering national notice for the $98.6 million project. The Arkansas River crossing between downtown Little Rock and North Little Rock is one of a dozen finalists for the 2017 America's ...
Gym Freaks 23/08/2017 09:12
It's #winitwednesday! Follow @theproteinball & GF's & RT!! #competition #prize #fitness #fitfam #protein #gym #gymlife #exercise #muscle
http://pic.twitter.com/zgoAWHa48h
It's #winitwednesday! Follow @theproteinball & GF's & RT!! #competition #prize #fitness #fitfam #protein #gym #gymlife #exercise #muscle<br>http://pic.twitter.com/zgoAWHa48h
Coco Fuzion 100 23/08/2017 09:10
#COMPETITION RT to win a #Fuzion100 pack full of our delicious sparkling coconut water! Make sure you follow us too - T&C's on our FB Page
http://pic.twitter.com/oyS0Ab0riJ
#COMPETITION RT to win a #Fuzion100 pack full of our delicious sparkling coconut water! Make sure you follow us too - T&C's on our FB Page<br>http://pic.twitter.com/oyS0Ab0riJ
Earl of March Lavant 23/08/2017 09:01
How would you like to #win a bottle of Calogera Prosecco? Just RT & follow our account to enter our #competition! #WinItWednesday Draw 01/09
http://pic.twitter.com/al5ONBox9V
How would you like to #win a bottle of Calogera Prosecco? Just RT & follow our account to enter our #competition! #WinItWednesday Draw 01/09<br>http://pic.twitter.com/al5ONBox9V
Mondo Gifts 23/08/2017 08:43
#COMPETITION Win a £10 gift voucher from http://www. mondogifts.co.uk   To enter LIKE this tweet FOLLOW @mondogifts & RETWEET #Winitwednesday
http://pic.twitter.com/pIZMrmBQeG
#COMPETITION Win a £10 gift voucher from  http://www. mondogifts.co.uk      To enter LIKE this tweet FOLLOW @mondogifts & RETWEET #Winitwednesday<br>http://pic.twitter.com/pIZMrmBQeG
Starplayer Games 23/08/2017 08:33
Follow& Retweet to enter #giveaway #Competition for a chance to #win this super fun #Man Utd #Starplayer Dice Game https://www. amazon.co.uk/Inspired-Games -International-Limited/b/ref=bl_dp_s_web_6624253031?ie=UTF8&node=6624253031&field-lbr_brands_browse-bin=Inspired+Games+International+Limited   …
http://pic.twitter.com/ziL9XgbQKW
Follow& Retweet to enter #giveaway #Competition for a chance to #win this super fun #Man Utd #Starplayer Dice Game   https://www. amazon.co.uk/Inspired-Games -International-Limited/b/ref=bl_dp_s_web_6624253031?ie=UTF8&node=6624253031&field-lbr_brands_browse-bin=Inspired+Games+International+Limited   … <br>http://pic.twitter.com/ziL9XgbQKW
Underfloor Heating 23/08/2017 08:22
#WIN a £10 @Love2shop_UK voucher! Just #RT & #Follow before 10pm! #competition #winitwednesday #win #wednesdaywisdom
http://pic.twitter.com/rFlCASKen2
#WIN a £10 @Love2shop_UK voucher! Just #RT & #Follow before 10pm! #competition #winitwednesday #win #wednesdaywisdom<br>http://pic.twitter.com/rFlCASKen2
Mondo Gifts 23/08/2017 08:13
#COMPETITION Set of fabulous 50/50 Pencils #WinitWednesday To Enter LIKE This Post, FOLLOW @mondogifts & RETWEET mondogifts.co.uk  
http://pic.twitter.com/9Fv8ZH5G9f
#COMPETITION Set of fabulous 50/50 Pencils #WinitWednesday To Enter LIKE This Post, FOLLOW @mondogifts & RETWEET  http:// mondogifts.co.uk     <br>http://pic.twitter.com/9Fv8ZH5G9f
Loveyourlegs 23/08/2017 08:06
#COMPETITION Retweet, Share & Follow for your chance to #win a bundle or 'Love Your Legs' #socks http://www. loveyourlegs.co.uk   #Giveaway
http://pic.twitter.com/nIVcWWrGXC
#COMPETITION Retweet, Share & Follow for your chance to #win a bundle or 'Love Your Legs' #socks   http://www. loveyourlegs.co.uk      #Giveaway<br>http://pic.twitter.com/nIVcWWrGXC
Push Doctor 23/08/2017 08:00
Mix up your diet RT & Follow to #WIN this NutriBullet Blender http://www. pushdoctor.co.uk/twitter   #WellnessWednesday #Competition Winner @ 9 tmrw
http://pic.twitter.com/vECYM6BGHk
Mix up your diet  RT & Follow to #WIN this NutriBullet Blender  http://www. pushdoctor.co.uk/twitter           #WellnessWednesday #Competition Winner @ 9 tmrw <br>http://pic.twitter.com/vECYM6BGHk
Wet Proof 23/08/2017 07:54
#win a Wet Proof can! RT+Follow @WetProofUK to enter #competition #winitWednesday #giveaway #freebie #comp Shop: https:// wetproof.uk/product/wet-pr oof-fabric-nanotechnology-waterproofing-spray/   …
http://pic.twitter.com/rSxnc2UnBp
Smooth Appeal 23/08/2017 07:45
Happy #WinItWednesday! FLW & RT with #GoSmooth to win our facial waxes! Ends 30.8. T&C's bit.ly/2pGvilj   #competition #comp
http://pic.twitter.com/TGHk9OrLA4
Happy #WinItWednesday! FLW & RT with #GoSmooth to win our facial waxes! Ends 30.8. T&C's  http:// bit.ly/2pGvilj      #competition #comp<br>http://pic.twitter.com/TGHk9OrLA4
Bristol Kids 23/08/2017 07:36
Last chance! FOLLOW US + RT for a chance to win 2 tickets to @FlipOutBristol's amazing trampolining party 2moro! Draw at noon! #Competition
http://pic.twitter.com/JOYGB9P6xp
Last chance! FOLLOW US + RT for a chance to win 2 tickets to @FlipOutBristol's amazing trampolining party 2moro! Draw at noon! #Competition <br>http://pic.twitter.com/JOYGB9P6xp
Power Direct 23/08/2017 07:29
#WinItWednesday Enter our #NEW #Competition #Giveaway for a Chance to #Win a George Foreman Health Grill. #RT & #Follow @PowerDirectUK
http://pic.twitter.com/PmEOujafC1
#WinItWednesday Enter our #NEW #Competition #Giveaway for a Chance to #Win a George Foreman Health Grill. #RT & #Follow @PowerDirectUK<br>http://pic.twitter.com/PmEOujafC1
Ropelet ® 23/08/2017 07:20
For a chance to #win this Ropelet and keyring bundle, Retweet this post, follow us by 5pm 29.8.17 . #Competition ropelet.co.uk  
http://pic.twitter.com/01uu85eeyq
For a chance to #win this Ropelet and keyring bundle, Retweet this post, follow us by 5pm 29.8.17 . #Competition   http:// ropelet.co.uk     <br>http://pic.twitter.com/01uu85eeyq
Andrew Dwerryhouse 23/08/2017 07:17
#competition #compers #comp Win £25 #voucher #twentyfive #pounds + #goodybag Follow Retweet drawn 25/8/2017
http://pic.twitter.com/MvRWgAu8JL
#competition #compers #comp  Win £25 #voucher #twentyfive #pounds + #goodybag Follow Retweet drawn 25/8/2017<br>http://pic.twitter.com/MvRWgAu8JL
Read More on Twitter